Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5L2 Peptide - C-terminal region

OR5L2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSHTPCRX16, HTPCRX16, OR11-153

UniProt

Q8NGL0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5L2 Rabbit Polyclonal Antibody (orb587623) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004739

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YCRPSSGNSGDVDKVATVFYTVVIPMLNPLIYSLRNKDVNKALRKVMGSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VCAM-1 CRISPR Activation Plasmid (h)
sc-400135-ACT 20 µg

VCAM-1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
1- (4-Propylphenyl) -1-pentyn-3-ol
OR1088629-01 250 mg

1- (4-Propylphenyl) -1-pentyn-3-ol

Sign In for Pricing
View Details
1- (4-Propylphenyl) -1-pentyn-3-ol
OR1088629-02 500 mg

1- (4-Propylphenyl) -1-pentyn-3-ol

Sign In for Pricing
View Details
1- (4-Propylphenyl) -1-pentyn-3-ol
OR1088629-03 1 g

1- (4-Propylphenyl) -1-pentyn-3-ol

Sign In for Pricing
View Details
1- (4-Propylphenyl) -1-pentyn-3-ol
OR1088629-04 5 g

1- (4-Propylphenyl) -1-pentyn-3-ol

Sign In for Pricing
View Details
Fastk 3'UTR Luciferase Stable Cell Line
TU204454 1.0 mL

Fastk 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details