Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6S1 Peptide - C-terminal region

OR6S1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR14-37, OR6S1Q

UniProt

Q8NH40

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6S1 Rabbit Polyclonal Antibody (orb587631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001968

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AIFLYVRPSQSGSVDTNWAVTVITTFVTPLLNPFIYALRNEQVKEALKDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR44 (PTGDR2) (N-term) Rabbit Polyclonal Antibody
AP22663PU-N 50 µg

GPR44 (PTGDR2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS706182 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS503718 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
APOBEC3D Polyclonal Antibody
E-AB-12980-01 20 µL

APOBEC3D Polyclonal Antibody

Sign In for Pricing
View Details
APOBEC3D Polyclonal Antibody
E-AB-12980-02 60 µL

APOBEC3D Polyclonal Antibody

Sign In for Pricing
View Details
APOBEC3D Polyclonal Antibody
E-AB-12980-03 120 µL

APOBEC3D Polyclonal Antibody

Sign In for Pricing
View Details