OR6S1 Peptide - C-terminal region
OR6S1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR14-37, OR6S1Q
UniProt
Q8NH40
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR6S1 Rabbit Polyclonal Antibody (orb587631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001001968
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AIFLYVRPSQSGSVDTNWAVTVITTFVTPLLNPFIYALRNEQVKEALKDM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HA750360 100 µL
Neutrophil Elastase Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
AP01544PU-N 100 µg
Caveolin 1 (CAV1) pTyr14 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNCB2218-100 1x 100 µL
CD9 (TSPAN29) (Motility-Related Protein-1) (P1/33/2), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
