Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POTEF Peptide - middle region

POTEF Peptide - middle region

Product Specifications

UniProt

A6NC16

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVPRKDLIVMLRDTDVNKQDKQKRTALHLASANGNSEVVKLLLDRRCQLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bik Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2427258 100 µL

Bik Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Human BLK Baculovirus-Insect cells Overexpression Lysate
MBS8114134-01 0.3 mg

Human BLK Baculovirus-Insect cells Overexpression Lysate

Sign In for Pricing
View Details
Human BLK Baculovirus-Insect cells Overexpression Lysate
MBS8114134-02 5x 0.3 mg

Human BLK Baculovirus-Insect cells Overexpression Lysate

Sign In for Pricing
View Details
KDM4B Antibody
CSB-PA991708-01 50 μL

KDM4B Antibody

Sign In for Pricing
View Details
KDM4B Antibody
CSB-PA991708-02 100 µL

KDM4B Antibody

Sign In for Pricing
View Details
Methyl (2R) -2-methylpyrrolidine-2-carboxylate hydrochloride
LBC76832-01 0.5 g

Methyl (2R) -2-methylpyrrolidine-2-carboxylate hydrochloride

Sign In for Pricing
View Details