Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POTEF Peptide - middle region

POTEF Peptide - middle region

Product Specifications

UniProt

A6NC16

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVPRKDLIVMLRDTDVNKQDKQKRTALHLASANGNSEVVKLLLDRRCQLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CBS Antibody Picoband®, iFluor647 Conjugate
A00130-3-iFluor647 100 µg

Anti-CBS Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Recombinant African cassava mosaic virus Replication-associated protein (AC1)
CSB-YP324434ADX-01 20 µg

Recombinant African cassava mosaic virus Replication-associated protein (AC1)

Sign In for Pricing
View Details
Recombinant African cassava mosaic virus Replication-associated protein (AC1)
CSB-YP324434ADX-02 100 µg

Recombinant African cassava mosaic virus Replication-associated protein (AC1)

Sign In for Pricing
View Details
Recombinant African cassava mosaic virus Replication-associated protein (AC1)
CSB-YP324434ADX-03 1 mg

Recombinant African cassava mosaic virus Replication-associated protein (AC1)

Sign In for Pricing
View Details
Rabbit anti-IFN beta Antibody
MBS4513451-01 0.05 mL

Rabbit anti-IFN beta Antibody

Sign In for Pricing
View Details
Rabbit anti-IFN beta Antibody
MBS4513451-02 0.1 mL

Rabbit anti-IFN beta Antibody

Sign In for Pricing
View Details