Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLCD1 Peptide - C-terminal region

TLCD1 Peptide - C-terminal region

Product Specifications

UniProt

A8MYP9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TLCD1 Rabbit Polyclonal Antibody (orb327116) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001153879

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANTXR2 (NM_058172) Human Over-expression Lysate
LC403300 20 µg

ANTXR2 (NM_058172) Human Over-expression Lysate

Sign In for Pricing
View Details
2,6-Dichloroaniline-3,4,5-d3
TRC-D431806-2MG 2 mg

2,6-Dichloroaniline-3,4,5-d3

Sign In for Pricing
View Details
Tide Quencher™ 1 maleimide [TQ1 maleimide]
2196-AAT 5 mg

Tide Quencher™ 1 maleimide [TQ1 maleimide]

Sign In for Pricing
View Details
D-Digitoxose
TRC-D445990-5MG 5 mg

D-Digitoxose

Sign In for Pricing
View Details
2-Chlorophenyl Cyclopentyl Ketone
TRC-C377820-2.5G 2.5 g

2-Chlorophenyl Cyclopentyl Ketone

Sign In for Pricing
View Details
(E)-3-(3-(2-Ethoxyphenyl)-3-oxoprop-1-en-1-yl)quinolin-2(1H)-one
TRC-E123668-100MG 100 mg

(E)-3-(3-(2-Ethoxyphenyl)-3-oxoprop-1-en-1-yl)quinolin-2(1H)-one

Sign In for Pricing
View Details