Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLCD1 Peptide - C-terminal region

TLCD1 Peptide - C-terminal region

Product Specifications

UniProt

A8MYP9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TLCD1 Rabbit Polyclonal Antibody (orb327116) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001153879

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT3 Human Gene Knockout Kit (CRISPR)
KN211115LP 1 Kit

WNT3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Dnase2a activation kit by CRISPRa
GA201101 1 Kit

Mouse Dnase2a activation kit by CRISPRa

Sign In for Pricing
View Details
ZAP-70 (Ab-315) Antibody
8B0601-AAT 50 µg

ZAP-70 (Ab-315) Antibody

Sign In for Pricing
View Details
FABP9 Mouse Monoclonal Antibody [Clone ID: AT13F9]
AM50091PU-S 50 µL

FABP9 Mouse Monoclonal Antibody [Clone ID: AT13F9]

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS714359 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
1-Aminoindane Hydrochloride
TRC-A612260-1G 1 g

1-Aminoindane Hydrochloride

Sign In for Pricing
View Details