TPSB2 Peptide - middle region
TPSB2 Peptide - middle region
Product Specifications
UniProt
Q6NZY1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TPSB2 Rabbit Polyclonal Antibody (orb587779) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7011343-01 0.02 mg
Recombinant Nicotiana tomentosiformis Chloroplast envelope membrane protein (cemA)
Sign In for Pricing
View Details MBS7011343-02 0.1 mg
Recombinant Nicotiana tomentosiformis Chloroplast envelope membrane protein (cemA)
Sign In for Pricing
View Details MBS7011343-03 5x 0.1 mg
Recombinant Nicotiana tomentosiformis Chloroplast envelope membrane protein (cemA)
Sign In for Pricing
View Details 
GTR15360653 1 Vial
Lentiviral human C1orf174 sgRNA gene knockout kit - Lentiviral human C1orf174 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details