TPSB2 Peptide - middle region
TPSB2 Peptide - middle region
Product Specifications
UniProt
Q6NZY1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TPSB2 Rabbit Polyclonal Antibody (orb587779) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
SL4766Hu-01 48 Tests
Human Interleukin 5 Receptor Alpha (IL5Ra) ELISA Kit
Sign In for Pricing
View Details SL4766Hu-02 96 Tests
Human Interleukin 5 Receptor Alpha (IL5Ra) ELISA Kit
Sign In for Pricing
View Details 
GTR15213776 1 Vial
Lentiviral mouse Fbxw19 shRNA (UAS) - Lentiviral mouseFbxw19 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details 
MBS966677-01 0.02 mg (E-Coli)
Recombinant Human Alpha-taxilin (TXLNA)
Sign In for Pricing
View Details