Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XKR8 Peptide - C-terminal region

XKR8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP11-460I13.3, XRG8

UniProt

Q9H6D3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with XKR8 Rabbit Polyclonal Antibody (orb587803) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060523

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CWKPDPDQVDGARSLLSPEGYQLPQNRRMTHLAQKFFPKAKDEAASPVKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camptothecin
6208 25 mg

Camptothecin

Sign In for Pricing
View Details
D-2’-Deoxyribofuranosyl-3-guanylurea(Alpha/Beta-Mixture)
TRC-D253500-10MG 10 mg

D-2’-Deoxyribofuranosyl-3-guanylurea(Alpha/Beta-Mixture)

Sign In for Pricing
View Details
Recombinant Human IL7R Protein (Fc Tag)
PDMH100238-01 20 µg

Recombinant Human IL7R Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL7R Protein (Fc Tag)
PDMH100238-02 100 µg

Recombinant Human IL7R Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL7R Protein (Fc Tag)
PDMH100238-03 500 µg

Recombinant Human IL7R Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL7R Protein (Fc Tag)
PDMH100238-04 1 mg

Recombinant Human IL7R Protein (Fc Tag)

Sign In for Pricing
View Details