XKR8 Peptide - C-terminal region
XKR8 Peptide - C-terminal region
Product Specifications
Product Name Alternative
RP11-460I13.3, XRG8
UniProt
Q9H6D3
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with XKR8 Rabbit Polyclonal Antibody (orb587803) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060523
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CWKPDPDQVDGARSLLSPEGYQLPQNRRMTHLAQKFFPKAKDEAASPVKG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI10B1]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908da2/imageurl/cf812568.webp)
CF812568 100 µg
TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI10B1]
Sign In for Pricing
View Details 
GF-TR-050 50 Preparations
GF-1 Total RNA Extraction Kit (Proteinase K & DNase I included), 50 preps
Sign In for Pricing
View Details 
E-EL-H3636-01 24 Tests
Human TSH (Thyroid Stimulating Hormone) ELISA Kit
Sign In for Pricing
View Details E-EL-H3636-02 48 Tests
Human TSH (Thyroid Stimulating Hormone) ELISA Kit
Sign In for Pricing
View Details