Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC20 Peptide - C-terminal region

ZDHHC20 Peptide - C-terminal region

Product Specifications

UniProt

Q5W0Z9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZDHHC20 Rabbit Polyclonal Antibody (orb587809) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF488A conjugate, 0.1mg/mL
BNC880189-500 1x 500 µL

CD74 (BU45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-100 1x 100 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (CLIP/1133), CF640R conjugate, 0.1mg/mL
BNC401133-500 1x 500 µL

CD74 (CLIP/1133), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2 + ICO-106), CF488A conjugate, 0.1mg/mL
BNC880735-100 1x 100 µL

Human Lambda Light Chain (LcN-2 + ICO-106), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-500 1x 500 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details