Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRB3 Peptide - middle region

GABRB3 Peptide - middle region

Product Specifications

Product Name Alternative

GABRB3

UniProt

P28472

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GABRB3 Rabbit Polyclonal Antibody (orb329581) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068712

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS805386 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
BMP8B Rabbit Polyclonal Antibody
AP20771PU-N 100 µg

BMP8B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HNF-4-alpha Recombinant Rabbit monoclonal Antibody
HA750254 100 µL

HNF-4-alpha Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF640R conjugate, 0.1mg/mL
BNC401118-100 1x 100 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
USHBP1 (NM_001297703) Human Tagged ORF Clone
RG239178 10 µg

USHBP1 (NM_001297703) Human Tagged ORF Clone

Sign In for Pricing
View Details
PAK6 (NM_020168) Human Over-expression Lysate
LY402760 100 µg

PAK6 (NM_020168) Human Over-expression Lysate

Sign In for Pricing
View Details