GABRB3 Peptide - middle region
GABRB3 Peptide - middle region
Product Specifications
Product Name Alternative
GABRB3
UniProt
P28472
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GABRB3 Rabbit Polyclonal Antibody (orb329581) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_068712
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740276-100 1x 100 µL
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Elab Bright™ Violet 421 Anti-Mouse CD62L Antibody[MEL-14]](https://cdn.genprice.uk/products/763/68dd3555061270361efa0ed6/imageurl/e-ab-f1011q2.webp)
E-AB-F1011Q2 50 Tests
Elab Bright™ Violet 421 Anti-Mouse CD62L Antibody[MEL-14]
Sign In for Pricing
View Details 
BNC943281-500 1x 500 µL
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3281), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942752-100 1x 100 µL
Heregulin-1 / Neuregulin-1 (Breast and Urothelial Marker) (NRG1/2752), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940917-100 1x 100 µL
Mucin 5AC (MUC5AC) (MUC5AC/917), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details