Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2F2 Peptide - middle region

E2F2 Peptide - middle region

Product Specifications

Product Name Alternative

E2F-2

UniProt

Q14209

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with E2F2 Rabbit Polyclonal Antibody (orb573866) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004082

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-SCNN1B (Ser633) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-5702R-BF647-TR 20 µL

Phospho-SCNN1B (Ser633) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
ABflo® 488 Rabbit anti-Mouse F4/80 mAb
A28286-01 50 μg

ABflo® 488 Rabbit anti-Mouse F4/80 mAb

Sign In for Pricing
View Details
ABflo® 488 Rabbit anti-Mouse F4/80 mAb
A28286-02 100 μg

ABflo® 488 Rabbit anti-Mouse F4/80 mAb

Sign In for Pricing
View Details
Mouse Brain antibody (FITC)
60R-BR002FT 2 mg

Mouse Brain antibody (FITC)

Sign In for Pricing
View Details
ASAP3 Polyclonal Antibody, Cy5 Conjugated
bs-5832R-Cy5 100 µL

ASAP3 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
NUSAP1 Rabbit Polyclonal Antibody (FITC)
orb2938215 100 µg

NUSAP1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details