E2F2 Peptide - middle region
E2F2 Peptide - middle region
Product Specifications
Product Name Alternative
E2F-2
UniProt
Q14209
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with E2F2 Rabbit Polyclonal Antibody (orb573866) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004082
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
21511160-1 1 mL
Sambucus nigra Lectin (SNA/EBL II) - Colloidal Gold
Sign In for Pricing
View Details 
A01974-Dyl550-carrier-free 100 µg
Anti-Human CD7 DyLight® 550 conjugated Antibody, Carrier-free
Sign In for Pricing
View Details CSB-EP025267HU1(F6)-01 20 µg
Recombinant Human Titin (TTN) , partial
Sign In for Pricing
View Details CSB-EP025267HU1(F6)-02 100 µg
Recombinant Human Titin (TTN) , partial
Sign In for Pricing
View Details CSB-EP025267HU1(F6)-03 1 mg
Recombinant Human Titin (TTN) , partial
Sign In for Pricing
View Details orb1671315 0.1 mg
Birch pollen allergen Bet v 1 Recombinant Protein
Sign In for Pricing
View Details