Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF232 Peptide - N-terminal region

ZNF232 Peptide - N-terminal region

Product Specifications

UniProt

Q9UNY5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF232 Rabbit Polyclonal Antibody (orb574709) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRQRFRHLRYQETPGPREALSQLRVLCCEWLRPEKHTKEQILEFLVLEQF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKD2 (polycystic kidney Disease 2 (Autosomal Dominant), APKD2, MGC138466, MGC138468, PC2, PKD4) (MaxLight 405) discontinued
250145-ML405 100 µL

PKD2 (polycystic kidney Disease 2 (Autosomal Dominant), APKD2, MGC138466, MGC138468, PC2, PKD4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
DMC1 (Disrupted Meiotic cDNA 1 Homolog, Disrupted Meiotic cDNA 1, Yeast Homolog of, DMC 1, DMC1, DMC1 Dosage Suppressor of Mck1 Homolog, DMC1 Dosage Suppressor of Mck1 Homolog Meiosis Specific Homologous Recombination (yeast), DMC1 Homologue) discontinued
376301 500 µg

DMC1 (Disrupted Meiotic cDNA 1 Homolog, Disrupted Meiotic cDNA 1, Yeast Homolog of, DMC 1, DMC1, DMC1 Dosage Suppressor of Mck1 Homolog, DMC1 Dosage Suppressor of Mck1 Homolog Meiosis Specific Homologous Recombination (yeast), DMC1 Homologue) discontinued

Sign In for Pricing
View Details
GRIN1 Polyclonal Antibody
E040986 100 µg -100 µL

GRIN1 Polyclonal Antibody

Sign In for Pricing
View Details
Collagen type I (native) Rat Protein
BA144 10 mg

Collagen type I (native) Rat Protein

Sign In for Pricing
View Details
CYP7B1 Peptide
orb1234266 0.1 mg

CYP7B1 Peptide

Sign In for Pricing
View Details
Anti-Zebrafish Hand2 Antibody, HRP Conjugate
DZ04652-HRP 200 µL/Vial

Anti-Zebrafish Hand2 Antibody, HRP Conjugate

Sign In for Pricing
View Details