Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF232 Peptide - N-terminal region

ZNF232 Peptide - N-terminal region

Product Specifications

UniProt

Q9UNY5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF232 Rabbit Polyclonal Antibody (orb574709) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRQRFRHLRYQETPGPREALSQLRVLCCEWLRPEKHTKEQILEFLVLEQF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HAdV-5 Penton protein/L2 Protein, C-Strep
VK476011-01 50 µg

Recombinant HAdV-5 Penton protein/L2 Protein, C-Strep

Sign In for Pricing
View Details
Recombinant HAdV-5 Penton protein/L2 Protein, C-Strep
VK476011-02 100 µg

Recombinant HAdV-5 Penton protein/L2 Protein, C-Strep

Sign In for Pricing
View Details
Recombinant HAdV-5 Penton protein/L2 Protein, C-Strep
VK476011-03 1 mg

Recombinant HAdV-5 Penton protein/L2 Protein, C-Strep

Sign In for Pricing
View Details
Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)
MBS9424288-01 0.02 mg

Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)

Sign In for Pricing
View Details
Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)
MBS9424288-02 0.1 mg

Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)

Sign In for Pricing
View Details
Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)
MBS9424288-03 1 mg

Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)

Sign In for Pricing
View Details