Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF682 Peptide - N-terminal region

ZNF682 Peptide - N-terminal region

Product Specifications

UniProt

O95779

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF682 Rabbit Polyclonal Antibody (orb575312) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NRENIRHTTEKLFKCMQCGKVFKSHSGLSYHKIIHTEEKLCICEECGKTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP13A1 Antibody
E94888 100 µg

ATP13A1 Antibody

Sign In for Pricing
View Details
Lentiviral human CA5B shRNA (UAS) - Lentiviral human CA5B shRNA (UAS) plasmid
GTR15085843 1 Vial

Lentiviral human CA5B shRNA (UAS) - Lentiviral human CA5B shRNA (UAS) plasmid

Sign In for Pricing
View Details
SOCS3 (Suppressor of Cytokine Signaling 3, ATOD4, CIS3, Cish3, MGC71791, SOCS-3, SSI-3, SSI3) (HRP)
MBS6182232-01 0.1 mL

SOCS3 (Suppressor of Cytokine Signaling 3, ATOD4, CIS3, Cish3, MGC71791, SOCS-3, SSI-3, SSI3) (HRP)

Sign In for Pricing
View Details
SOCS3 (Suppressor of Cytokine Signaling 3, ATOD4, CIS3, Cish3, MGC71791, SOCS-3, SSI-3, SSI3) (HRP)
MBS6182232-02 5x 0.1 mL

SOCS3 (Suppressor of Cytokine Signaling 3, ATOD4, CIS3, Cish3, MGC71791, SOCS-3, SSI-3, SSI3) (HRP)

Sign In for Pricing
View Details
RGS22 Human shRNA Plasmid Kit (Locus ID 26166)
TR302014 1 Kit

RGS22 Human shRNA Plasmid Kit (Locus ID 26166)

Sign In for Pricing
View Details
Rrh sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3381107 1.0 µg DNA

Rrh sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details