Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF682 Peptide - N-terminal region

ZNF682 Peptide - N-terminal region

Product Specifications

UniProt

O95779

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF682 Rabbit Polyclonal Antibody (orb575312) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NRENIRHTTEKLFKCMQCGKVFKSHSGLSYHKIIHTEEKLCICEECGKTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Collectrin (TMEM27) ELISA Kit
MBS7220417-01 48 Well

Rabbit Collectrin (TMEM27) ELISA Kit

Sign In for Pricing
View Details
Rabbit Collectrin (TMEM27) ELISA Kit
MBS7220417-02 96 Well

Rabbit Collectrin (TMEM27) ELISA Kit

Sign In for Pricing
View Details
Rabbit Collectrin (TMEM27) ELISA Kit
MBS7220417-03 5x 96 Well

Rabbit Collectrin (TMEM27) ELISA Kit

Sign In for Pricing
View Details
Rabbit Collectrin (TMEM27) ELISA Kit
MBS7220417-04 10x 96 Well

Rabbit Collectrin (TMEM27) ELISA Kit

Sign In for Pricing
View Details
PCGF4/BMI1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61372R-BF750-01 20 µL

PCGF4/BMI1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
PCGF4/BMI1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61372R-BF750-02 100 µL

PCGF4/BMI1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details