Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF735 Peptide - middle region

ZNF735 Peptide - middle region

Product Specifications

UniProt

P0CB33

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF735 Rabbit Polyclonal Antibody (orb575894) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001152996

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NTQNKIFQTHKCVKVFSKFSNSNRHNARYTGKKHLKCKKYGKSFCMFSHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-742-5p miRNA Agomir
orb1916528-01 5 nmol

Rno-miR-742-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-742-5p miRNA Agomir
orb1916528-02 10 nmol

Rno-miR-742-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-742-5p miRNA Agomir
orb1916528-03 20 nmol

Rno-miR-742-5p miRNA Agomir

Sign In for Pricing
View Details
Recombinant Fibulin 3 (FBLN3)
SIPF770Mu02-01 10 µg

Recombinant Fibulin 3 (FBLN3)

Sign In for Pricing
View Details
Recombinant Fibulin 3 (FBLN3)
SIPF770Mu02-02 50 µg

Recombinant Fibulin 3 (FBLN3)

Sign In for Pricing
View Details
Recombinant Fibulin 3 (FBLN3)
SIPF770Mu02-03 200 µg

Recombinant Fibulin 3 (FBLN3)

Sign In for Pricing
View Details