ZNF735 Peptide - middle region
ZNF735 Peptide - middle region
Product Specifications
UniProt
P0CB33
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF735 Rabbit Polyclonal Antibody (orb575894) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001152996
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NTQNKIFQTHKCVKVFSKFSNSNRHNARYTGKKHLKCKKYGKSFCMFSHL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal Lysozyme Antibody (095) [mFluor Violet 450 SE]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
NBP3-30754MFV450 0.1 mL
Mouse Monoclonal Lysozyme Antibody (095) [mFluor Violet 450 SE]
Sign In for Pricing
View Details 
K3687508 1.0 µg DNA
Tmem178 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
Sign In for Pricing
View Details 51459121 3x 1.0µg DNA
ZNF33A CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details OR1095454-01 1 g
(2-Chloropyridin-4-yl) (4-methylpiperazin-1-yl) methanone
Sign In for Pricing
View Details OR1095454-02 5 g
(2-Chloropyridin-4-yl) (4-methylpiperazin-1-yl) methanone
Sign In for Pricing
View Details