Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF140 Peptide - C-terminal region

ZNF140 Peptide - C-terminal region

Product Specifications

UniProt

Q05CP6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF140 Rabbit Polyclonal Antibody (orb576390) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSGSELIRHQITHTGEKPYECIECGKAFRRFSHLTRHQSIHTTKTPYECN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human IgG1 Antibody
KC-1616-01 50 μL

Anti-Human IgG1 Antibody

Sign In for Pricing
View Details
Anti-Human IgG1 Antibody
KC-1616-02 100 µL

Anti-Human IgG1 Antibody

Sign In for Pricing
View Details
Anti-Human IgG1 Antibody
KC-1616-03 1 mL

Anti-Human IgG1 Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Thymus
CB502617 1 Block

Frozen Tissue Blocks, Thymus

Sign In for Pricing
View Details
AKR1D1 (NM_005989) Human Over-expression Lysate
LC401810 20 µg

AKR1D1 (NM_005989) Human Over-expression Lysate

Sign In for Pricing
View Details
NOX1 Human Gene Knockout Kit (CRISPR)
KN210426BN 1 Kit

NOX1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details