Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF140 Peptide - C-terminal region

ZNF140 Peptide - C-terminal region

Product Specifications

UniProt

Q05CP6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF140 Rabbit Polyclonal Antibody (orb576390) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSGSELIRHQITHTGEKPYECIECGKAFRRFSHLTRHQSIHTTKTPYECN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zuclopenthixol-d4 (-)-10-Camphorsulfonic Acid Salt
TRC-Z701497-1MG 1 mg

Zuclopenthixol-d4 (-)-10-Camphorsulfonic Acid Salt

Sign In for Pricing
View Details
C12orf56 (NM_001170633) Human Over-expression Lysate
LY433360 100 µg

C12orf56 (NM_001170633) Human Over-expression Lysate

Sign In for Pricing
View Details
Avilamycin (~80%)
TRC-A794655-250MG 250 mg

Avilamycin (~80%)

Sign In for Pricing
View Details
4-Phenoxyaniline
TRC-P317283-1G 1 g

4-Phenoxyaniline

Sign In for Pricing
View Details
Total RNA Purification Kit-50p
17200 50 Preparations

Total RNA Purification Kit-50p

Sign In for Pricing
View Details
Human TRPV4 activation kit by CRISPRa
GA111827 1 Kit

Human TRPV4 activation kit by CRISPRa

Sign In for Pricing
View Details