Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF586 Peptide - middle region

ZNF586 Peptide - middle region

Product Specifications

UniProt

Q9NXT0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF586 Rabbit Polyclonal Antibody (orb576626) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSSLLQHQRVHTRERPYECSECGKSFSLRSNLIHHQRVHTGERHECGQCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Difficile atpD Protein (aa 1-222)
VAng-Lsx9089-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Difficile atpD Protein (aa 1-222)

Sign In for Pricing
View Details
EIF4ENIF1 (NM_001164501) Human Untagged Clone
SC327687 10 µg

EIF4ENIF1 (NM_001164501) Human Untagged Clone

Sign In for Pricing
View Details
IGF-BP4 Recombinant Protein
40-318-0005mg 0.005 mg

IGF-BP4 Recombinant Protein

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL)
MBS2038625-01 0.1 mL

FITC-Linked Polyclonal Antibody to Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL)
MBS2038625-02 0.2 mL

FITC-Linked Polyclonal Antibody to Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL)
MBS2038625-03 0.5 mL

FITC-Linked Polyclonal Antibody to Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL)

Sign In for Pricing
View Details