Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF586 Peptide - middle region

ZNF586 Peptide - middle region

Product Specifications

UniProt

Q9NXT0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF586 Rabbit Polyclonal Antibody (orb576626) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSSLLQHQRVHTRERPYECSECGKSFSLRSNLIHHQRVHTGERHECGQCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL13 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV714458 1.0 µg DNA

RPL13 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
anti-PKC delta
YF-PA13994 100 ug

anti-PKC delta

Sign In for Pricing
View Details
Bovine GP173 ELISA Kit
E103089 1 Each

Bovine GP173 ELISA Kit

Sign In for Pricing
View Details
Anti-BIRC6 / Apollon antibody
STJ70295 100 µg

Anti-BIRC6 / Apollon antibody

Sign In for Pricing
View Details
Goat A kinase anchor protein 4 (AKAP4) ELISA Kit
GTR10344895 96 Well

Goat A kinase anchor protein 4 (AKAP4) ELISA Kit

Sign In for Pricing
View Details
Mouse Anti-human CD34/PE antibody
BF00602-01 25 Tests

Mouse Anti-human CD34/PE antibody

Sign In for Pricing
View Details