SSX5 Peptide - C-terminal region
SSX5 Peptide - C-terminal region
Product Specifications
UniProt
O60225
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SSX5 Rabbit Polyclonal Antibody (orb576775) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRVRERKQLVIYE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSM040727 100 µg
Recombinant Mouse CD147/Basigin Protein (aa 1-209, His Tag)
Sign In for Pricing
View Details 
LC424045 20 µg
Annexin A13 (ANXA13) (NM_001003954) Human Over-expression Lysate
Sign In for Pricing
View Details 
