Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBXA2R Peptide - C-terminal region

TBXA2R Peptide - C-terminal region

Product Specifications

Product Name Alternative

TXA2-R, BDPLT13

UniProt

P21731

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBXA2R Rabbit Polyclonal Antibody (orb330271) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001051.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYSGAISAHCNLRLPGSSDSSASACQVAGTTGTRPSWMQPPCLPSRWWAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cleaved LC3A Antibody (ATG8a/APG8a)
F46138-0.4ML 0.4 mL

Cleaved LC3A Antibody (ATG8a/APG8a)

Sign In for Pricing
View Details
RUNX2 Antibody
KC-25980-01 50 μL

RUNX2 Antibody

Sign In for Pricing
View Details
RUNX2 Antibody
KC-25980-02 100 µL

RUNX2 Antibody

Sign In for Pricing
View Details
RUNX2 Antibody
KC-25980-03 1 mL

RUNX2 Antibody

Sign In for Pricing
View Details
ATOH1 Human Gene Knockout Kit (CRISPR)
KN210192RB 1 Kit

ATOH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDE3B Rabbit Polyclonal Antibody
AP00654SU-N 100 µL

PDE3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details