Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBXA2R Peptide - C-terminal region

TBXA2R Peptide - C-terminal region

Product Specifications

Product Name Alternative

TXA2-R, BDPLT13

UniProt

P21731

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBXA2R Rabbit Polyclonal Antibody (orb330271) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001051.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYSGAISAHCNLRLPGSSDSSASACQVAGTTGTRPSWMQPPCLPSRWWAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tex26 Mouse Gene Knockout Kit (CRISPR)
KN517440 1 Kit

Tex26 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nkx3.1 (NKX3-1) (NM_006167) Human Over-expression Lysate
LY401858 100 µg

Nkx3.1 (NKX3-1) (NM_006167) Human Over-expression Lysate

Sign In for Pricing
View Details
XFD532 NHS Ester
1819-AAT 1 mg

XFD532 NHS Ester

Sign In for Pricing
View Details
GPC1 Mouse Monoclonal Antibody [Clone ID: OTI8F3]
CF812439 100 µg

GPC1 Mouse Monoclonal Antibody [Clone ID: OTI8F3]

Sign In for Pricing
View Details
Recombinant Human IL-36 beta protein (His Tag)
PKSH034118-01 20 µg

Recombinant Human IL-36 beta protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL-36 beta protein (His Tag)
PKSH034118-02 100 µg

Recombinant Human IL-36 beta protein (His Tag)

Sign In for Pricing
View Details