Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMTC2 Peptide - C-terminal region

TMTC2 Peptide - C-terminal region

Product Specifications

UniProt

F8VRQ2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMTC2 Rabbit Polyclonal Antibody (orb325439) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLNTGIILMNQGRTEEARRTFLKCSEIPDENLKDPHAHKSSVTSCLYNLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDZD8 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-9043R-BF647-TR 20 µL

PDZD8 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
C1GALT1C1 Antibody
OACA08547-50UL 50 µL

C1GALT1C1 Antibody

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Carbonic Anhydrase II (CA2)
MBS2047352-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Carbonic Anhydrase II (CA2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Carbonic Anhydrase II (CA2)
MBS2047352-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Carbonic Anhydrase II (CA2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Carbonic Anhydrase II (CA2)
MBS2047352-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Carbonic Anhydrase II (CA2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Carbonic Anhydrase II (CA2)
MBS2047352-04 1 mL

Cy3-Linked Polyclonal Antibody to Carbonic Anhydrase II (CA2)

Sign In for Pricing
View Details