Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMTC2 Peptide - C-terminal region

TMTC2 Peptide - C-terminal region

Product Specifications

UniProt

F8VRQ2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMTC2 Rabbit Polyclonal Antibody (orb325439) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLNTGIILMNQGRTEEARRTFLKCSEIPDENLKDPHAHKSSVTSCLYNLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carnoys Fixative
RRFF6000-F 2.5 L

Carnoys Fixative

Sign In for Pricing
View Details
EBF2 (NM_022659) Human Untagged Clone
SC317986 10 µg

EBF2 (NM_022659) Human Untagged Clone

Sign In for Pricing
View Details
Geminin Recombinant Antibody
bsm-61750R-TR 20 µL

Geminin Recombinant Antibody

Sign In for Pricing
View Details
PON3 (Paraoxonase 3, Serum paraoxonase/lactonase 3)
364717 200 µL

PON3 (Paraoxonase 3, Serum paraoxonase/lactonase 3)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) AHL1 Polyclonal Antibody
MBS7170307 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) AHL1 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Protein Kinase C Theta (PKCq) ELISA Kit
QY-E10171 96 Tests

Rat Protein Kinase C Theta (PKCq) ELISA Kit

Sign In for Pricing
View Details