THSD1 Peptide - middle region
THSD1 Peptide - middle region
Product Specifications
UniProt
Q9NS62
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with THSD1 Rabbit Polyclonal Antibody (orb580698) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
132439 100 µg
RCSD1 (RCSD Domain-containing Protein 1, CapZ-interacting Protein, CAPZIP, Protein Kinase Substrate CapZIP, MK2S4, RP3-503M14.1)
Sign In for Pricing
View Details E53A05972 50 µg
Recombinant Human Endothelial Differentiation-Related Factor 1/EDF1/MBF1 Protein (C-6His)
Sign In for Pricing
View Details 
abx692943-01 10 µg
Human Sentrin-Specific Protease 8 (SENP8) Protein
Sign In for Pricing
View Details abx692943-02 50 µg
Human Sentrin-Specific Protease 8 (SENP8) Protein
Sign In for Pricing
View Details K0669606 1.0 µg DNA
EIF4E sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details