Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THSD1 Peptide - middle region

THSD1 Peptide - middle region

Product Specifications

UniProt

Q9NS62

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THSD1 Rabbit Polyclonal Antibody (orb580698) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H2BB Protein Vector (Human) (pPM-C-His)
PV053052 500 ng

HIST1H2BB Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
USP36 Double Nickase Plasmid (m)
sc-428319-NIC 20 µg

USP36 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Human GRHL2 shRNA Plasmid
abx962702-01 150 µg

Human GRHL2 shRNA Plasmid

Sign In for Pricing
View Details
Human GRHL2 shRNA Plasmid
abx962702-02 300 µg

Human GRHL2 shRNA Plasmid

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At5g23360 Polyclonal Antibody
MBS9006932 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At5g23360 Polyclonal Antibody

Sign In for Pricing
View Details
3- (3-Methoxypropyl) -6-phenyl-2-sulfanyl-3H,4H-thieno[2,3-d]pyrimidin-4-one
HFB22193-01 250 mg

3- (3-Methoxypropyl) -6-phenyl-2-sulfanyl-3H,4H-thieno[2,3-d]pyrimidin-4-one

Sign In for Pricing
View Details