Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF763 Peptide - C-terminal region

ZNF763 Peptide - C-terminal region

Product Specifications

UniProt

B4DRE7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF763 Rabbit Polyclonal Antibody (orb581073) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CRKAFTYPSSLRRHERTHSAKKPYECKQCGKALSYKFSNTPKNALWRKTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGF1 Receptor (IGF1R) pTyr1165/1166 Rabbit Polyclonal Antibody
AP01611PU-N 100 µg

IGF1 Receptor (IGF1R) pTyr1165/1166 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NEU2 (NM_005383) Human Over-expression Lysate
LC401652 20 µg

NEU2 (NM_005383) Human Over-expression Lysate

Sign In for Pricing
View Details
KV4.3 Rabbit Polyclonal Antibody
ER1802-91 100 µL

KV4.3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
USP12P1 Human qPCR Primer Pair (XM_033651)
HP220758 200 Reactions

USP12P1 Human qPCR Primer Pair (XM_033651)

Sign In for Pricing
View Details
Human RPL17-C18orf32 activation kit by CRISPRa
GA119350 1 Kit

Human RPL17-C18orf32 activation kit by CRISPRa

Sign In for Pricing
View Details
iFluor™ 488 Conjugated Cytokeratin 15 Recombinant Rabbit Monoclonal Antibody [ST04-85]
HA720136F 100 µL

iFluor™ 488 Conjugated Cytokeratin 15 Recombinant Rabbit Monoclonal Antibody [ST04-85]

Sign In for Pricing
View Details