ZNF763 Peptide - C-terminal region
ZNF763 Peptide - C-terminal region
Product Specifications
UniProt
B4DRE7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF763 Rabbit Polyclonal Antibody (orb581073) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CRKAFTYPSSLRRHERTHSAKKPYECKQCGKALSYKFSNTPKNALWRKTL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AN300123L-01 20 µL
Recombinant Phospho-CREB (Ser133) Monoclonal Antibody
Sign In for Pricing
View Details AN300123L-02 100 µL
Recombinant Phospho-CREB (Ser133) Monoclonal Antibody
Sign In for Pricing
View Details 
GAF-443-40 1 mL
Colloidal Gold Conjugated Goat Purified Antibody To Mouse IgG, (Min.x-rxn.), 40nm
Sign In for Pricing
View Details 
