Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF763 Peptide - C-terminal region

ZNF763 Peptide - C-terminal region

Product Specifications

UniProt

B4DRE7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF763 Rabbit Polyclonal Antibody (orb581073) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CRKAFTYPSSLRRHERTHSAKKPYECKQCGKALSYKFSNTPKNALWRKTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDRG1 Mouse Monoclonal Antibody [Clone ID: OTI1F5]
CF808878 100 µg

PDRG1 Mouse Monoclonal Antibody [Clone ID: OTI1F5]

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF647 conjugate, 0.1mg/mL
BNC472000-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: left
CR561662 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
Human Cys-C Antibody Pair Set
E-KAB-0020 50 µL & 100 µg

Human Cys-C Antibody Pair Set

Sign In for Pricing
View Details
Myosin (MYL4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A2]
TA807577AM 100 µL

Myosin (MYL4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A2]

Sign In for Pricing
View Details
Agroclavine
TRC-A430040-2.5MG 2.5 mg

Agroclavine

Sign In for Pricing
View Details