ZNF840P Peptide - middle region
ZNF840P Peptide - middle region
Product Specifications
Product Name Alternative
C20orf157, ZNF840
UniProt
A6NDX5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF840P Rabbit Polyclonal Antibody (orb581207) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FSNLTQHKRIHTGEKPYKCKECCKAFNKFSNLTQHKRIHTGEKPYKCEEC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx149819-01 50 µg
DIRAS Family, GTP-Binding RAS-Like 2 (DIRAS2) Antibody
Sign In for Pricing
View Details abx149819-02 100 µg
DIRAS Family, GTP-Binding RAS-Like 2 (DIRAS2) Antibody
Sign In for Pricing
View Details ![GBA3 Mouse Monoclonal Antibody [Clone ID: OTI3E8]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
K0299704 1.0 µg DNA
C14orf72 sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
MBS1375382-01 0.02 mg (E-Coli)
Recombinant Staphylococcus haemolyticus UPF0398 protein SH1465 (SH1465)
Sign In for Pricing
View Details