Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF840P Peptide - middle region

ZNF840P Peptide - middle region

Product Specifications

Product Name Alternative

C20orf157, ZNF840

UniProt

A6NDX5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF840P Rabbit Polyclonal Antibody (orb581207) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSNLTQHKRIHTGEKPYKCKECCKAFNKFSNLTQHKRIHTGEKPYKCEEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-SMARCA2/BRM antibody
SLM-60621R-01 50 µL

Rabbit Anti-SMARCA2/BRM antibody

Sign In for Pricing
View Details
Rabbit Anti-SMARCA2/BRM antibody
SLM-60621R-02 100 µL

Rabbit Anti-SMARCA2/BRM antibody

Sign In for Pricing
View Details
Human DEFB126 / Beta-Defensin 126 Recombinant Protein
MBS2903137 Inquire

Human DEFB126 / Beta-Defensin 126 Recombinant Protein

Sign In for Pricing
View Details
RMP Antibody
MBS8588573-01 0.1 mg

RMP Antibody

Sign In for Pricing
View Details
RMP Antibody
MBS8588573-02 0.1 mL (AF405L)

RMP Antibody

Sign In for Pricing
View Details
RMP Antibody
MBS8588573-03 0.1 mL (AF405S)

RMP Antibody

Sign In for Pricing
View Details