Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YME1L1 Peptide - C-terminal region

YME1L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FTSH, MEG4, PAMP, YME1L

UniProt

Q96TA2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YME1L1 Rabbit Polyclonal Antibody (orb325732) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001240795.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDFDNATKIAKRMVTKFGMSEKLGVMTYSDTGKLSPETQSAIEQEIRILL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
BNC680178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-500 1x 500 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/835), CF594 conjugate, 0.1mg/mL
BNC940835-500 1x 500 µL

Cytokeratin 18 (KRT18/835), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF647 conjugate, 0.1mg/mL
BNC472052-100 1x 100 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/1783R), CF594 conjugate, 0.1mg/mL
BNC941783-100 1x 100 µL

CD45RB (B-Cell Marker) (PTPRC/1783R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, beta (p120) (CTNNB1/2099), CF405S conjugate, 0.1mg/mL
BNC042099-100 1x 100 µL

Catenin, beta (p120) (CTNNB1/2099), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details