EFCAB13 Peptide - middle region
EFCAB13 Peptide - middle region
Product Specifications
UniProt
Q8IY85
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RKFLGGVGSSNVGVQEPYSKNGINFKKHSEKGEIHDSKSKPQSLKSSTSL
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1472364-01 0.02 mg (E-Coli)
Recombinant Yersinia pestis bv. Antiqua Glucokinase (glk)
Sign In for Pricing
View Details 
MBS1472364-02 0.02 mg (Yeast)
Recombinant Yersinia pestis bv. Antiqua Glucokinase (glk)
Sign In for Pricing
View Details 
MBS1472364-03 0.1 mg (E-Coli)
Recombinant Yersinia pestis bv. Antiqua Glucokinase (glk)
Sign In for Pricing
View Details MBS1472364-04 0.1 mg (Yeast)
Recombinant Yersinia pestis bv. Antiqua Glucokinase (glk)
Sign In for Pricing
View Details MBS1472364-05 0.02 mg (Baculovirus)
Recombinant Yersinia pestis bv. Antiqua Glucokinase (glk)
Sign In for Pricing
View Details