Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFCAB13 Peptide - middle region

EFCAB13 Peptide - middle region

Product Specifications

UniProt

Q8IY85

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKFLGGVGSSNVGVQEPYSKNGINFKKHSEKGEIHDSKSKPQSLKSSTSL

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP3 Rabbit Polyclonal Antibody (BF647)
orb2480861 100 µL

LRP3 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
BCL2 Like 11 Protein
abx262529-01 2 µg

BCL2 Like 11 Protein

Sign In for Pricing
View Details
BCL2 Like 11 Protein
abx262529-02 10 µg

BCL2 Like 11 Protein

Sign In for Pricing
View Details
BCL2 Like 11 Protein
abx262529-03 1 mg

BCL2 Like 11 Protein

Sign In for Pricing
View Details
Mouse Rhomboid-related protein 3, Rhbdl3 ELISA KIT
ELI-14571m 96 Tests

Mouse Rhomboid-related protein 3, Rhbdl3 ELISA KIT

Sign In for Pricing
View Details
Impg2 (NM_174876) Mouse Tagged ORF Clone Lentiviral Particle
MR211845L3V 200 µL

Impg2 (NM_174876) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details