IDH3G Peptide - C-terminal region
IDH3G Peptide - C-terminal region
Product Specifications
Product Name Alternative
H-IDHG
UniProt
P51553
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IDH3G Rabbit Polyclonal Antibody (orb582453) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004126.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YMTRHNNLDLVIIREQTEGEYSSLEHEVRPQKLGEGKDEDGREVELLVSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![GSK3 beta (GSK3B) (N-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 11B9]](https://cdn.genprice.uk/products/937/68dd1899061270361e8fb5f6/imageurl/am00066pu-n.webp)
AM00066PU-N 100 µg
GSK3 beta (GSK3B) (N-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 11B9]
Sign In for Pricing
View Details 
TRC-D486377-5MG 5 mg
3,10-Dioxododecanedioic-13C12 Acid 1,12-Diethyl Ester
Sign In for Pricing
View Details 
LY426401 100 µg
TBC1D14 (NM_001113361) Human Over-expression Lysate
Sign In for Pricing
View Details