IDH3G Peptide - C-terminal region
IDH3G Peptide - C-terminal region
Product Specifications
Product Name Alternative
H-IDHG
UniProt
P51553
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IDH3G Rabbit Polyclonal Antibody (orb582453) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004126.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YMTRHNNLDLVIIREQTEGEYSSLEHEVRPQKLGEGKDEDGREVELLVSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP761242 50 µg
Thymidine Kinase 2 (TK2) (NM_004614) Human Recombinant Protein
Sign In for Pricing
View Details 
PDEM100281-01 20 µg
Recombinant Mouse MME/CD10/Neprilysin protein (His tag)
Sign In for Pricing
View Details PDEM100281-02 100 µg
Recombinant Mouse MME/CD10/Neprilysin protein (His tag)
Sign In for Pricing
View Details PDEM100281-03 500 µg
Recombinant Mouse MME/CD10/Neprilysin protein (His tag)
Sign In for Pricing
View Details PDEM100281-04 1 mg
Recombinant Mouse MME/CD10/Neprilysin protein (His tag)
Sign In for Pricing
View Details 