APIP Peptide - N-terminal region
APIP Peptide - N-terminal region
Product Specifications
UniProt
Q96GX9
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with APIP Rabbit Polyclonal Antibody (orb583313) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AARSDEIYIAPSGVQKERIQPEDMFVCDINEKDISGPSPSKKLKKSQCTP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GP-6301-15 1 mL
Colloidal Gold Conjugated Artocarpus integrifolia Lectin (Jackfruit) -Jacalin, AIA-, 15nm
Sign In for Pricing
View Details ![ErbB 3 (ERBB3) Mouse Monoclonal Antibody [Clone ID: OTI3C1]](https://cdn.genprice.uk/products/937/68dd18ba061270361e908530/imageurl/cf809228.webp)
CF809228 100 µg
ErbB 3 (ERBB3) Mouse Monoclonal Antibody [Clone ID: OTI3C1]
Sign In for Pricing
View Details 
LY422399 100 µg
Archaemetzincin 2 (AMZ2) (NM_001033574) Human Over-expression Lysate
Sign In for Pricing
View Details 
