Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APIP Peptide - N-terminal region

APIP Peptide - N-terminal region

Product Specifications

UniProt

Q96GX9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APIP Rabbit Polyclonal Antibody (orb583313) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AARSDEIYIAPSGVQKERIQPEDMFVCDINEKDISGPSPSKKLKKSQCTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISG20 (NM_001303237) Human Tagged ORF Clone
RG236183 10 µg

ISG20 (NM_001303237) Human Tagged ORF Clone

Sign In for Pricing
View Details
2-Bromo-9,9-dioctyl Fluorene
TRC-B678860-50MG 50 mg

2-Bromo-9,9-dioctyl Fluorene

Sign In for Pricing
View Details
PE Anti-Human CD2 Antibody[G11]
AN00572D-01 20 Tests

PE Anti-Human CD2 Antibody[G11]

Sign In for Pricing
View Details
PE Anti-Human CD2 Antibody[G11]
AN00572D-02 100 Tests

PE Anti-Human CD2 Antibody[G11]

Sign In for Pricing
View Details
PE Anti-Human CD2 Antibody[G11]
AN00572D-03 2x 100 Tests

PE Anti-Human CD2 Antibody[G11]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD49b/pan-NK cells Antibody[DX5]
E-AB-F1116G-01 50 Tests

PE/Cyanine5 Anti-Mouse CD49b/pan-NK cells Antibody[DX5]

Sign In for Pricing
View Details