ENOSF1 Peptide - middle region
ENOSF1 Peptide - middle region
Product Specifications
UniProt
J3QL81
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ENOSF1 Rabbit Polyclonal Antibody (orb583386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDILGHATISKALVP
More Discoveries
Explore Other Products
Browse additional items from our catalog
S212025LC 25 L
Sodium Hydroxide (Low in Carbonate) 1.2M (1.2N) - 25L
Sign In for Pricing
View Details 
