Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENOSF1 Peptide - middle region

ENOSF1 Peptide - middle region

Product Specifications

UniProt

J3QL81

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENOSF1 Rabbit Polyclonal Antibody (orb583386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDILGHATISKALVP

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPAK Antibody (Center)
orb1928722-01 50 µL

SPAK Antibody (Center)

Sign In for Pricing
View Details
SPAK Antibody (Center)
orb1928722-02 100 µL

SPAK Antibody (Center)

Sign In for Pricing
View Details
TCEA1P1 3'UTR GFP Stable Cell Line
TU075268 1.0 mL

TCEA1P1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MCHR1 Polyclonal Antibody
E918111 100 µL

MCHR1 Polyclonal Antibody

Sign In for Pricing
View Details
Msp-77 Antibody
orb801035 2 mg

Msp-77 Antibody

Sign In for Pricing
View Details
HCN3 (B-12) : m-IgG Fc BP-HRP Bundle
sc-540340 1 Kit

HCN3 (B-12) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details