Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TESC Peptide - N-terminal region

TESC Peptide - N-terminal region

Product Specifications

UniProt

J3KPN1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TESC Rabbit Polyclonal Antibody (orb583428) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD2/CD2 Antibody Picoband® (Dylight488 Conjugate)
PA1743-Dylight488 100 µg

Anti-CD2/CD2 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Csf1r sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3415604 1.0 µg DNA

Csf1r sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse Serpina3j shRNA (UAS) - Lentiviral mouse Serpina3j shRNA (UAS, RFP) (25)
GTR15228071 1 Vial

Lentiviral mouse Serpina3j shRNA (UAS) - Lentiviral mouse Serpina3j shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Phospho-Merlin (Ser10) BioAssayTM ELISA Kit
473220 2x 96 Tests

Phospho-Merlin (Ser10) BioAssayTM ELISA Kit

Sign In for Pricing
View Details
Mrm2 Rat Pre-designed siRNA Set A
HY-RS26421 1 Set

Mrm2 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
N-Acetylglucosamine Kinase, NT (N-acetyl-D-glucosamine Kinase, NAGK, GlcNAc Kinase, GNK, HSA242910)
MBS626599-01 0.2 mL

N-Acetylglucosamine Kinase, NT (N-acetyl-D-glucosamine Kinase, NAGK, GlcNAc Kinase, GNK, HSA242910)

Sign In for Pricing
View Details