Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TESC Peptide - N-terminal region

TESC Peptide - N-terminal region

Product Specifications

UniProt

J3KPN1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TESC Rabbit Polyclonal Antibody (orb583428) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adam1a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6896108 1.0 µg DNA

Adam1a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
SCARA5 Protein Vector (Mouse) (pPM-C-HA)
PV226872 500 ng

SCARA5 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Rickettsia canadensis ATP synthase subunit a (atpB)
MBS7008877-01 0.02 mg

Recombinant Rickettsia canadensis ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Rickettsia canadensis ATP synthase subunit a (atpB)
MBS7008877-02 0.1 mg

Recombinant Rickettsia canadensis ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Rickettsia canadensis ATP synthase subunit a (atpB)
MBS7008877-03 5x 0.1 mg

Recombinant Rickettsia canadensis ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Porcine Interleukin-15 (IL-15) Recombinant
IPCIL15R5UG 1 Each

Porcine Interleukin-15 (IL-15) Recombinant

Sign In for Pricing
View Details