Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tdp1 Peptide - C-terminal region

Tdp1 Peptide - C-terminal region

Product Specifications

UniProt

Q8BJ37

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TDP1 Rabbit Polyclonal Antibody (orb326159) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRPPGKSAVPLHLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQRWLHSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF594 conjugate, 0.1mg/mL
BNC941025-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD262 / DR5 (DR5/3381), 1mg/mL
BNUM3381-50 1x 50 µL

CD262 / DR5 (DR5/3381), 1mg/mL

Sign In for Pricing
View Details
PE Anti-Human CD305 Antibody[NKTA255]
AN00330D-01 20 Tests

PE Anti-Human CD305 Antibody[NKTA255]

Sign In for Pricing
View Details
PE Anti-Human CD305 Antibody[NKTA255]
AN00330D-02 100 Tests

PE Anti-Human CD305 Antibody[NKTA255]

Sign In for Pricing
View Details
PE Anti-Human CD305 Antibody[NKTA255]
AN00330D-03 2x 100 Tests

PE Anti-Human CD305 Antibody[NKTA255]

Sign In for Pricing
View Details
6-Hydroxy Melatonin
TRC-H944625-5MG 5 mg

6-Hydroxy Melatonin

Sign In for Pricing
View Details