PARVG Peptide - N-terminal region
PARVG Peptide - N-terminal region
Product Specifications
UniProt
Q9HBI0
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PARVG Rabbit Polyclonal Antibody (orb326220) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSM040803 200 µg
Recombinant Mouse ALK-1/ACVRL1 Protein (His & Fc Tag)
Sign In for Pricing
View Details